SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CA3260 from Candida albicans SC5314

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CA3260
Domain Number 1 Region: 96-216
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.87e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 5-88
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.04e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CA3260
Sequence length 219
Comment IPF7968 unknown function
Sequence
MTKPIQFYTYGTPNGFKVSIFLEVLGLAYETISVDITKNESKSDWFVKLNPNGRIPTIVD
PNFKDGEITISQTGAILQYLADNYDKEHKYSYAFGTEEYYKTLEYLIFQVSENGPIQGQL
NHFKLFAKEKIEYGITRYENDTKRIYGVYEDILKRNSANDSKYLVGDRYTVADYALFGWA
YSLHKVGIDIHDWPLLGKWFDALNKDPAVIKGVNVPEKK
Download sequence
Identical sequences C4YHF3 Q5AFB4
CAWT_03499 CA3260 XP_720446.1.88832 5476.CAL0003548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]