SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CA4437 from Candida albicans SC5314

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CA4437
Domain Number 1 Region: 1-172
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.97e-31
Family YKR049C-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CA4437
Sequence length 172
Comment IPF13867 unknown function
Sequence
MSLFRSLQNSPSTISIFHNSSIPLSNKLYDILEKAYDTQPEKPKHEFQIDLMKNKMPTYD
QYKLIVDKYLKGSTSKTILHNCFPFLHDSKTELYNSKGNVVTVKGVEWANKTFSPAEYQM
IYDTFNKLQESSDQSINTIASNVFQAPLVVDWDNDVIAGDEETLKAILSKYN
Download sequence
Identical sequences C4YTY9 G1UAZ9 Q9UVI8
CAWT_05637 XP_716980.1.88832 5476.CAL0002595 CA4437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]