SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CA4625 from Candida albicans SC5314

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CA4625
Domain Number 1 Region: 3-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.55e-30
Family Thioltransferase 0.003
Further Details:      
 
Domain Number 2 Region: 132-310
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.38e-29
Family Hypothetical protein AT3g04780/F7O18 27 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CA4625
Sequence length 327
Comment IPF5742 thioredoxin-like protein (by homology)
Sequence
MSIKFVKSSKDFEGYLKNNTHLVLNFTASWCGPCQAIKPVIDQAYGQFQNVEIVRIDLDS
QRELASKYNITSVPTFVFLETGKEVDRIQGANPQALITKLQEFNTKANGQKRRGNGTASE
DLITQNSSLKDIKPLIPKNFEILNATIDYSGYEVLNCLPLYKDSKTKHVVSLDNTDKSAV
ISDSDSQLLFYIPFLNISKIYSILVKVKSTKTYKEVDESALDVDSDDLDEIQPPNLIKVW
CNTQSILSFDEASADTSAPHIEKVSTNDEEQWLDIKFKFVRFQNVQNLTIFVDGEDEDYH
TVIEKIVIVGVNGESKEQGKINQIDDE
Download sequence
Identical sequences Q5A915
5476.CAL0004078 CA4625 XP_718142.1.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]