SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CA4649 from Candida albicans SC5314

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CA4649
Domain Number 1 Region: 11-170
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.16e-50
Family Glutathione peroxidase-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CA4649
Sequence length 171
Comment CaGPX4 glutathione peroxidase (by homology)
Sequence
MGNELLSTARIYTFKIPDAYNNVIDFDQFKNKVILIVNVASLCGFTPQYKELQLLYEKYH
ERGLEILGFPCNQFGNQEPLQEEEIVESCRRNFGVSFPIMKKTKVNIDCDGHESELYKYL
KSEKPGEVGFKGVRWNFEKFIVNRKGEVVARFNSLITPLQLEGFIEQLLSE
Download sequence
Identical sequences C4YDT6 Q59WD3
XP_713880.1.88832 5476.CAL0001814 CA4649 CAWT_00684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]