SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CA4810 from Candida albicans SC5314

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CA4810
Domain Number 1 Region: 46-207
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-54
Family NQO2-like 0.0000994
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CA4810
Sequence length 243
Comment IPF1164 Subunit NUHM of NADH:Ubiquinone Oxidoreductase (by homology)
Sequence
MLARFIGKSTTTPVGVYASTVSKRYSSIISVHRDTKEDNPNIAFEFNSENKKRAEEIIAK
YPPQYKKGACMPLLDLGQRQLGFTSISVMNYVAKLLDMPPMRVYEVATFYTMYNRHPMGK
YNLQVCTTTPCQLCGSDSIMKAITDYLKIKPGQTTPDKLFTLQEVECLGACVNAPMIAIN
DDYHEDLSPEATINLLKQLQEGKELTEIGPVDGKRQSCEPFSGPKVLLNKEPNDIRKFTR
ADL
Download sequence
Identical sequences C4YJ08
5476.CAL0004559 CA4810 CAWT_03820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]