SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CA4919 from Candida albicans SC5314

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CA4919
Domain Number 1 Region: 22-117
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.03e-25
Family Thioltransferase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CA4919
Sequence length 119
Comment CaTTR1 Glutaredoxin (by homology)
Sequence
MFRTLLTKRLFNTSTMVSSQVKNKVEQLIKTKPVFIASKSYCPYCKATKSTIEAITKDAY
ILELDEVDDGAEIQEALLEITGQRTVPNVFIGGQHIGGNSDVQALKSSDKLDDKIKAAL
Download sequence
Identical sequences C4YFK6 Q5ABB1
5476.CAL0005151 CA4919 CAWT_01324 XP_719021.1.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]