SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CA4963 from Candida albicans SC5314

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CA4963
Domain Number 1 Region: 23-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.69e-27
Family Thioltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CA4963
Sequence length 123
Comment IPF3919 unknown function
Sequence
MSSILAWGFNLWYQPPPPTAQTEKEIEHTINSHKIVIYSKTYCPFCDQTKHLLNEQYPQE
SYEVINLNILDDGLTIQNQLYANTGQYMVPIIFINGQHVGGNSEVQQLHTNGKLQELLNP
QKY
Download sequence
Identical sequences A0A1D8PR08 C4YTR2
5476.CAL0003068 XP_721348.2.88832 CA4963 CAWT_05557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]