SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CA4964 from Candida albicans SC5314

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CA4964
Domain Number 1 Region: 63-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 2e-30
Family Thioltransferase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CA4964
Sequence length 156
Comment IPF3920 unknown function
Sequence
MDYFQTEKTTETRQQRQQKKRPVRNSIICTLSLSYQPNFVMSSLIGWLSSWFQNEPITPE
LKKEIESNINSHKVLVYSKSYCPYCTSTKTLLQSLNQDYKVIELDQIPKGSAIQNGLQEL
TGQRTVPNVFINGKHIGGNSDIQALHSQGKLKPLFG
Download sequence
Identical sequences C4YTR3 G1UAU6 Q5AH29
CAWT_05558 CA4964 5476.CAL0003046 XP_721347.1.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]