SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CA4968 from Candida albicans SC5314

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CA4968
Domain Number - Region: 58-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0125
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CA4968
Sequence length 153
Comment IPF3928 unknown function
Sequence
MSTRMFITSKNKYNKKIENAIKKINKLTANPETSFKFDAERFKEIELFVYGQRPITYKPA
WGLKLFWKDNLPTLRYHNPDIQFTVNNITVESESELSKLPLKLKVHGTDQSNSFEINCTD
KPPSKILSELIEITKARKLTEEELPKLPLRPVK
Download sequence
Identical sequences C4YTR7 G1UAT6 Q5AH35
CAWT_05562 CA4968 5476.CAL0003032 XP_721341.1.88832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]