SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CA5773 from Candida albicans SC5314

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CA5773
Domain Number 1 Region: 44-194
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.49e-29
Family Glutathione peroxidase-like 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CA5773
Sequence length 263
Comment CaDOT5 Derepression of telomeric silencing (by homology)
Sequence
MPELRRSARVAARPAKEPEAVTEQPPTKKVKTAPTNTAKPDAGLGIGEKIPDVTLLNQDG
EEISLTEVAKGSKYVVIFAFPRASTSGCARQVSGFRKLDKDYKDVSIFGVSSDSVKAQKN
FQTKQNAEYDLLSDPEKKLIGALGAKKHPSGIIRSHWIFVDGVLKVKQIQVSPEVSFTSA
EEEIKKFINENENGKEATENDVTKEEVKEESQQDDKEDNTEQTDEKATEQTQDEVKKVSD
ETKVEDETEEKPTEEQKTEAPVV
Download sequence
Identical sequences C4YPI2 Q5A7P9
XP_717789.1.88832 CAWT_02383 CA5773 5476.CAL0005188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]