SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ANID_00170T0 from Aspergillus nidulans FGSC A4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ANID_00170T0
Domain Number 1 Region: 82-188
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.55e-32
Family Thioltransferase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ANID_00170T0
Sequence length 189
Comment | ANID_00170 | Aspergillus nidulans FGSC A4 thioredoxin (190 aa)
Sequence
MSSLGLTNQASTVLRALRPRCLRPSAVSVSSARSLTTRASTLTFTVSRPRISVPKNYNSF
AKRAFSSSPTVFFHPSAAKMGASEHVPPITSKAEFQEKVLNAKGFVVVDCFATWCGPCKA
IAPTVEKFAQTYTDASFYQIDVDELSEVAAELGIRAMPTFLLFKDGQKVSDVVGANPGAL
EAGIKALLA
Download sequence
Identical sequences 162425.CADANIAP00002566 ANID_00170T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]