SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ANID_02848T0 from Aspergillus nidulans FGSC A4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ANID_02848T0
Domain Number 1 Region: 6-138
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.59e-33
Family spliceosomal protein U5-15Kd 0.00000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ANID_02848T0
Sequence length 143
Comment | ANID_02848 | Aspergillus nidulans FGSC A4 mitosis protein dim1 (144 aa)
Sequence
MGSVVLPHLRTAWHVDQAILSEEDRLVVIRFGRDHDVDCMRQDEVLFKIAERVKNFAVIY
LCDIDEVPEFNTMYELFDPMTIMFFFRNKHIMCDFGTGNNNKLNWVLEDKQELIDIIETI
YKGARKGRGLVVSPKDYSTRYRY
Download sequence
Identical sequences A0A1U8QWD6 Q5B9D2
XP_660452.1.1458 162425.CADANIAP00010243 ANID_02848T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]