SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ANID_03687T0 from Aspergillus nidulans FGSC A4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ANID_03687T0
Domain Number 1 Region: 31-183
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.25e-26
Family Glutathione peroxidase-like 0.0000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ANID_03687T0
Sequence length 184
Comment | ANID_03687 | Aspergillus nidulans FGSC A4 AhpC/TSA family protein (185 aa)
Sequence
MFASRRLTAAASVPRAFSQRALFHRTAPAFVQKGDPIPDLDVLVENSPGNKVNLAKELKG
KGVIIGVPAAFSPACSSTHVPGYISHPKLKEAGQVFVVAVNDPFVTKAWGTTLDPTGKSG
IRFLGDPTGKFSEALDVTFDSTTIFGNQRSKRYALLVEDGKIKEAFVEPDNTGVKVSTAE
NVLG
Download sequence
Identical sequences C8V7M1
ANID_03687T0 162425.CADANIAP00005041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]