SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ANID_04304T0 from Aspergillus nidulans FGSC A4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ANID_04304T0
Domain Number 1 Region: 40-146
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.97e-32
Family Thioltransferase 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ANID_04304T0
Sequence length 149
Comment | ANID_04304 | Aspergillus nidulans FGSC A4 glutaredoxin Grx5 (150 aa)
Sequence
MFSRTAISFTLRRSLFRPQLSPQFPNQLPSVLQARLLSTETKAAIDKAVASAPVVLFMKG
TPETPQCGFSRASIQILGLQGVDPKKFVAFNVLEDPELRQGIKEYSDWPTIPQLYLNKEF
IGGCDILMSMHQNGELSKLLEEKGVLVAE
Download sequence
Identical sequences A0A1U8QGU4 Q5B576
XP_661908.1.1458 162425.CADANIAP00006161 ANID_04304T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]