SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ANID_06563T0 from Aspergillus nidulans FGSC A4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ANID_06563T0
Domain Number 1 Region: 250-411
Classification Level Classification E-value
Superfamily eEF1-gamma domain 3.79e-63
Family eEF1-gamma domain 0.0000481
Further Details:      
 
Domain Number 2 Region: 83-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.43e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.00037
Further Details:      
 
Domain Number 3 Region: 1-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000585
Family Glutathione S-transferase (GST), N-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ANID_06563T0
Sequence length 411
Comment | ANID_06563 | Aspergillus nidulans FGSC A4 translation elongation factor eEF-1 subunit gamma (412 aa)
Sequence
MAFGKLYGRPDNTRTIAVLVAAKHNDLELELVETQANPAADFNKSDAYTKIQPLGKIPAF
EGANGFTLSEVIAIAVYVTSQNEKTTLLGKTKQDYASILRWLSFANSELLVSFGSWFRPL
LGLDPYNKKNVEDASKAALKKLGVLNTHLTANTYLVGERITLADLFTASLLTRAFATVID
KKVRADYPAVTRWYQTIIDQSAFKAVVENPVLIDEAIKYTPPKKEEKPKKEAAPAAAAPA
AEEDKPAPKPKHPLEALGKPTLILDDWKRTYSNEDTRSVAMPWFWQNYKPEEYSLWKVNY
KYDNELKLTFMANNLIGGFHARLEASRKYLFGCQGVYGENYACVNRGVFLVRGQEALPAF
DVAPDYESYEFIKLDHTNEADRKYVEDIWAWDTPVVVDGKELPNVDGHVFK
Download sequence
Identical sequences A0A1U8QFU4 Q5AYR7
XP_664167.1.1458 162425.CADANIAP00007337 ANID_06563T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]