SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ANID_06709T0 from Aspergillus nidulans FGSC A4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ANID_06709T0
Domain Number 1 Region: 789-984
Classification Level Classification E-value
Superfamily Sec7 domain 2.62e-71
Family Sec7 domain 0.00000575
Further Details:      
 
Domain Number 2 Region: 1257-1668,1876-1964
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000000115
Family MIF4G domain-like 0.055
Further Details:      
 
Weak hits

Sequence:  ANID_06709T0
Domain Number - Region: 466-669,710-729
Classification Level Classification E-value
Superfamily ARM repeat 0.00166
Family Mo25 protein 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ANID_06709T0
Sequence length 1997
Comment | ANID_06709 | Aspergillus nidulans FGSC A4 guanyl-nucleotide exchange factor (1998 aa)
Sequence
MAEAENDPTNELNQTSVTQADKQNGVDVATEPHAPEVVAESKPALTDESERQEIPTIKEN
EDTMANNRLNDSKNNLPHEPSVTSPDTTTDSNEPTDEPEQPHTEGDQLETLQQDQPPASD
EQLNEAPDAPSTRDEQLAQDMRQRSDSRSTTATFATNRSSVVSSTVFIVTALDAIGASRE
ARKSKELEDAVKNALANVKQSDRQPIDPEILFYPLLLASRTLSIPLQVTALDCIGKLITY
SYFAFPSAQEAKPSEADATAEQPPLIERAIDAICDCFENEATPIEIQQQIIKSLLAAVLN
DKIVVHGAGLLKAVRQIYNMFIYSKSSQNQQIAQGSLTQMVSTVFDRLRVRLDLRELRIR
EGEKAQAGSSESVTIEPVVSPPSAEDDQASDVASVAADQPVSKEPTEKLTLESFESNKDV
TTVNDNVPTMVTRANINQKRTQSYSGTSSEEKEAEDASSNEDDVDEIYVKDAFLVFRALC
KLSHKVLSHEQQQDLKSQNMRSKLLSLHLIHYLINNHVIIFTTPLLTLKNSSGNLEAMTF
LQAIRPHLCLSLSRNGASSVPKVFEVCCEIFWLMLKHMRVMMKKELEVFMKEIYLAILEK
RNAPAFQKQYFMEILERLADEPRALVEMYLNYDCDRTALENIFQNIIEQLSRYASIPTVV
NPLQQQQYHELHVKASSVGNEWHQRGTLPPNLTSASIGNNQQPPTHSVPSEYILKHQAVE
CLVVILESLDNWASQRSVDPTAARTFSQKSVDNPRDSMDSSAPAFLASPRVDGADGSTGR
STPVPDDDPSQVEKVKQRKIALTNVIQQFNFKPKRGVKLALQEGFIRSDSPEDIAAFILR
NDRLDKAMIGEYLGEGDAENIATMHAFVDMMDFSKRRFVDALRSFLQHFRLPGEAQKIDR
FMLKFSERYVTQNPNAFANADTAYVLAYSVILLNTDQHSSKMKGRRMTKEDFIKNNRGIN
DNQDLPDEYLGSIFDEIANNEIVLDTEREQAANAAHPAPVPSGLASRAGQVFATVGRDIQ
GERYAQASEEMANKTEQLYRSLIRAQRKTAVKEALSRFIFATSVQHAGSMFNVTWMSFLS
GLSAPMQDTQNLKTIKLCMEGMKLAIRISCTFDLETPRVAFVTALAKFTNLGNVREMVAK
NVEAVKILLDVALSEGNHLKSSWRDILTCVSQLDRLQLLSDGVDEGSLPDMSRAGVVPPS
ASDGPRRSMQAPRRPRPKSITGPTPFRAEIAMESRSTEMVKGVDRIFTNTANLSHEAIID
FVRALSEVSWQEIQSSGQTASPRTYSLQKLVEISYYNMTRVRIEWSKIWEVLGQHFNQVG
CHSNTTVVFFALDSLRQLSMRFMEIEELPGFKFQKDFLKPFEHVMSNSNAVTVKDMILRC
LIQMIQARGDNIRSGWKTMFGVFSFAAREPYEGIVNMAFEHVTQIYNTRFGVVITQGAFP
DLVVCLTEFSKNTRFQKKSLQAIELLKSTVAKMLRTPECPLSHRSSTEAFHEDSTNLTQQ
LTKQSKEEQFWYPILIAFQDILMTGDDLEARSRALTYLFDTLIRYGGSFPQEFWDVLWRQ
LLYPIFVVLQSKSEMSKVPNHEELSVWLSTTMIQALRHMITLFTHYFDALEYMLGRVLEL
LTLCICQENDTIARIGSNCLQQLILQNVEKFQKDHWNKTVGAFIELFNKTTAYELFTAAT
TMATVTLKTPSAPTANGQLADTHDTVQDPTESSPAQETSTEPPKLNGTQDTTAEHEDGDM
PAASNTELEDYRPQSDTQQQPAAVTAARRRYFNRIITSCVLQLLMIETVHELFSNDKVYA
QIPSHELLRLMGLLKKSYQFAKKFNEDKELRMQLWRQGFMKSPPNLLKQESGSAATYVHI
LFRMYHDEREERKSSRSETEAALIPLCVDIISGFVRLDEDSQHRNIVAWRPVVVDVIEGY
TNFPAEGFDKHIDTFYPLAVDLLGRELNSEIRLAIQGLFQRIGEARLGLPVRPTPTPVSP
RHSVSEHPSRKHSVGRR
Download sequence
Identical sequences ANID_06709T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]