SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ANID_08692T0 from Aspergillus nidulans FGSC A4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ANID_08692T0
Domain Number 1 Region: 34-167
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.54e-28
Family Glutathione peroxidase-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ANID_08692T0
Sequence length 168
Comment | ANID_08692 | Aspergillus nidulans FGSC A4 putative peroxiredoxin pmp20 (169 aa)
Sequence
MSGLKAGDSFPADVVFSYIPWTEEKGEITSCGIPINYYASKEWADKKVILFALPGAFTPV
CSARHVPEYIERLPEIRAKGVDVVAVLAYNDAFVMSAWGKANGVKNDDILFLSDPEAKFS
KSIGWADEEGRTKRYAIVLDHGKVTYAALEPAKNHLEFSSAETVIKHL
Download sequence
Identical sequences Q5ASN8
ANID_08692T0 XP_681961.1.1458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]