SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ANID_11843T0 from Aspergillus nidulans FGSC A4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ANID_11843T0
Domain Number 1 Region: 11-91
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000833
Family Thioltransferase 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ANID_11843T0
Sequence length 100
Comment | ANID_11843 | Aspergillus nidulans FGSC A4 glutaredoxin domain-containing protein (101 aa)
Sequence
MFPTARLLQARVTLFTRAGCGLCDTAKHTVTQLHKRRPFDYSEVDIMAPGNKEWKDVYEL
DVPVLHVQSGTGALSDPKKLFHRWTEQEVETLVDNAEKTP
Download sequence
Identical sequences ANID_11843T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]