SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118431040|ref|NP_147221.2| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431040|ref|NP_147221.2|
Domain Number 1 Region: 32-190
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000000455
Family ATP-dependent protease Lon (La), catalytic domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118431040|ref|NP_147221.2|
Sequence length 600
Comment hypothetical protein APE_0428.1 [Aeropyrum pernix K1]
Sequence
MLTSLAAPSTAASGDDARTIYYLLPAVEGESDSRGRLIEATLSVKPSPGGGFKVVAGGEV
DPTTELSMKMAALNALLLAGVSCRSVEVSISIRSQGPVAGPSGSLATAVAVVMAAAGYDD
VSVHGNYGYVITGAITPGGLAAKVGGIPAKCAAANREGYVLAIPLSNKADAPPDCSYAAV
AGVLDALSLMGWPRPAFSYRGGLPEAFNESMLGIAEDMRSNALKALEDARGRVPREDYSR
ESEAIKGLIERSVEAERYSPYAAASLAFTALTRAYTLSYLASLQEGLKPGEALAGLESEL
ESLRAELDGMEKEGSMLYIEMLAVAYTRLADAEASIESLKASPPGEPSSAAAQLGYIKAR
LESVEGWLKTAGAVKDIGRELRSEDLRIIYSVFREYGYTSADYGRSLVEYMINAYNLPEG
RFAPYLAALSKLVSEARMYEERGNYVAAIGFLRDAVSMTLQVVSAAPEEAPQPEDLELYR
REMEAIISVLLARASSLGFQSGLTEAYIQYAEVLAGDDPQLAIAMMEEATASAILWSIAA
EAMESQLEAPAQPAPTGQDTLAQRIETGAVVAFAFATAGLLFTLGVYITARSFARSSRIW
Download sequence
Identical sequences Q9YF10
gi|118431040|ref|NP_147221.2| 272557.APE_0428.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]