SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118431077|ref|NP_147276.2| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431077|ref|NP_147276.2|
Domain Number 1 Region: 13-198
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 4.6e-30
Family NADH oxidase/flavin reductase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118431077|ref|NP_147276.2|
Sequence length 201
Comment hypothetical protein APE_0492.1 [Aeropyrum pernix K1]
Sequence
MGLPEPTKVSGVDVLEAIRRRRSRRSFSRRPLTLTEVSTILFHVAGITGLAWWGGPKRPY
PSAGALQPVEAYLVVERVEGLKPGLYHYNPSGHCLEMLREGKLLGRLADVSLGQDHVAEA
AAALVLTAVYTRTGSKYGHRSYRYVHWDTGFAGENVYLVCEALGLATVAVGAFYDDEMCG
FLEIDCPWEMPMLVFPVGARG
Download sequence
Identical sequences Q9YET9
gi|118431077|ref|NP_147276.2| 272557.APE_0492.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]