SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118431102|ref|NP_147317.2| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431102|ref|NP_147317.2|
Domain Number 1 Region: 315-429
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.00000000000691
Family Pseudouridine synthase II TruB 0.0048
Further Details:      
 
Weak hits

Sequence:  gi|118431102|ref|NP_147317.2|
Domain Number - Region: 156-194
Classification Level Classification E-value
Superfamily THUMP domain-like 0.0174
Family THUMP domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118431102|ref|NP_147317.2|
Sequence length 437
Comment pseudouridylate synthase [Aeropyrum pernix K1]
Sequence
MDSRVLESALRALSRYPLCDRCLGRLFARLGRGWSNRERGEAVKRVLVMELHRRVLEGDE
AALKTLVSAAPNIGEVARDVVEHLSPGSYREGGPCAVCGGRLESVIASAVEEGYRLLRAY
DIERFVVGVRLERGVAMAEEEVKLAAGAGYGESIKAEIRREVGKLLVSRGGVTVDFDSPE
ATLMVEFPGGGVDIQVNSLLYKARYWKLARNISQAYWPTPEGPRYFSVEQALWPVLKLTG
GERLVVHAAGREDVDARMLGSGRPMIVEVKSPRRRRIPLEELEAAANAGGKGLVRFRFET
AAKRAEVALYKEETARVRKVYRALVAVEGGVSEVDVEGLRRALEGAVIMQRTPSRVLHRR
PDILRRRRLYSLDCSPLEGAPLMECILEAEGGLYIKELVSGDGGRTRPSFAEVLGREAVC
IELDVVWVEHEAPAAPG
Download sequence
Identical sequences Q9YEN2
272557.APE_0546.1 gi|118431102|ref|NP_147317.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]