SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118431160|ref|NP_147433.2| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431160|ref|NP_147433.2|
Domain Number 1 Region: 336-495
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-60
Family DNA gyrase/MutL, second domain 0.00000182
Further Details:      
 
Domain Number 2 Region: 36-253
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.19e-31
Family DNA gyrase/MutL, N-terminal domain 0.000000595
Further Details:      
 
Domain Number 3 Region: 256-328
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.0000000883
Family Topoisomerase VI-B subunit middle domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118431160|ref|NP_147433.2|
Sequence length 568
Comment DNA topoisomerase VI subunit B [Aeropyrum pernix K1]
Sequence
MSAVAKRTRRARARAEEAARPGSTGEKYREMSVAEFFAKNKELAGFANPTRALYQTIREL
VENSLDATDAKGILPWIHISIRQIEGSEGRGGRPRYTVTVEDNGIGVPVTSMAMAFGKVL
FSSKYVIRQTRGMYGLGVKAAILYGQMTAGTPVEVYSATKGSQYVYMMKLVIDVQRNEPR
ILERGEWNKRGSWHGTRVTLSLEGDWSRAKSKILEYIKRTAVIAPYAEIILETPDGEIYY
FPRSTRKLPKPPRESKPHPHGVDIEQLKSMLRSTRASTLREFLVKEFQSIGDKTAQDFLE
KYGLDPDLKPRELLKKGRDKLLRRLADALMEYPFRAPKSDYLSPIGSDIIEIGLRRMFNP
EWVGAVSRSPKAYRGHPFIVEVGIAYGGGIEARSEPLLLRYANKIPLLYEEREDVSYKVV
SSINWRQYNVDFPAPLVVLVHIASTKVPYKGVGKESVSDVPEIEAEIRNAVQEVARRLRL
YLSRKAREEEAIRRSVTLAKYIPEVAVSLAYFLRPPSKWQPPKPEEVKKIQEALIKIVAR
HIELPPVDGKTEDPEAIVRRIVESVELE
Download sequence
Identical sequences Q9YE64
NYSGRC-FDAO-118431160 gi|118431160|ref|NP_147433.2| 272557.APE_0706.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]