SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118431199|ref|NP_147498.2| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431199|ref|NP_147498.2|
Domain Number 1 Region: 5-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.74e-28
Family Nitrogenase iron protein-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118431199|ref|NP_147498.2|
Sequence length 262
Comment GTPase [Aeropyrum pernix K1]
Sequence
MIGYIIVTGTAGAGKSSLVGALADRITSLGANVATLNLDPAAEKLPYDPSVDARDYVSVA
ELMDKGLGPNGALVAAVDSLINHVLDIREEIDYYSPDYVVVDTPGQLELFAYRVGGPLVL
RGIMGDYNGVNIFLIDSIFIDNAISLVSALLLASSVAVRLGLPQVNAVSKADMLLPEVRE
EVIPRLGEPGFLEFLLEKDKTYEGAGKALAEELARAIETTGFIGEVLQASVLEPETVTLL
AAKAQQILAGGDDYKIYDITGQ
Download sequence
Identical sequences Q9YDX8
gi|118431199|ref|NP_147498.2| 272557.APE_0791.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]