SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118431292|ref|NP_147652.2| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431292|ref|NP_147652.2|
Domain Number 1 Region: 20-259
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.34e-73
Family Pseudouridine synthase II TruB 0.000000531
Further Details:      
 
Domain Number 2 Region: 261-343
Classification Level Classification E-value
Superfamily PUA domain-like 5.25e-19
Family PUA domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118431292|ref|NP_147652.2|
Sequence length 354
Comment H/ACA RNA-protein complex component Cbf5p [Aeropyrum pernix K1]
Sequence
MAEEAVDARGEGARFIEKVKSICGNTSRILYKYDEPTDPRYGYLPHERPLDVYLRYGMIV
VDKPPGPTSHEVVAWIKRMLGVSRAGHGGTLDPKVTGVLPVALERMTRIIGTVMHSSKEY
VCVMQLHRPVEEDRLREVLKLFEGEIYQKPPLRSSVKRALRTRRVFRIELLEYTGKYALL
RVDCEAGTYMRKLCWDIGLVLGVGAHMRELRRIRTGPFSEDSGLMVRLDDVAYAVIRWRE
EGKDDLLRRVVIPGEYSVCHIPKVLVRDSAVESLTHGAQLAAPGVAAVEEGVEKGGMVAL
MTLKGELIGLGKALASAQEMLEAERGIVVSPTRIIMERGLYPRMWKRQQAPQGA
Download sequence
Identical sequences Q18NW4 Q9YDC3
272557.APE_0989.1 gi|118431292|ref|NP_147652.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]