SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118431671|ref|NP_148300.2| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431671|ref|NP_148300.2|
Domain Number 1 Region: 157-441
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.64e-72
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000123
Further Details:      
 
Domain Number 2 Region: 8-115
Classification Level Classification E-value
Superfamily tRNA-binding arm 6.8e-21
Family Seryl-tRNA synthetase (SerRS) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118431671|ref|NP_148300.2|
Sequence length 460
Comment seryl-tRNA synthetase [Aeropyrum pernix K1]
Sequence
MAGWSILELLRSNPEALKEHVRKRLMDPAIVDRAYRLDVEWRRLLTMVNEVRRRHNEITR
MIAKAGSREERERLIAEAKRLLREREDLEEKLKKVEREREEALLGLPNIVAPDVPVGDES
ATRPIEFWGKPKVWKGHVDAFREQTEAYGFKVDHEVIEWRPRGHADMMEEVLKLGDTLRA
ARVAGSRFYYLFEDLVFLDLALLMYAIDFMTSKGYVLVLPPYMLRYNVMSRVIDLETFKD
AIYEIAGEDLYLIATAEHPLAALYYNSEIYDEDLPLKLVGVSPCFRKEAGAGNRDLKGIF
RVHQFHKVEQFVYSLPEESSKLHEELISNAKEIFKGLEIPFRVVNIASGDLGACAVKKYD
LEAWMPAQGKYREMVSASNCTDWQAYRLGIRLVRRKGMERGYVHTLNATAVASTRTITAI
LENFQDEEGVVAIPRALRRYLEVFKRAPTDAIHPRRRPPA
Download sequence
Identical sequences Q9YAG3
gi|118431671|ref|NP_148300.2| 272557.APE_1976.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]