SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118431850|ref|NP_148567.2| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431850|ref|NP_148567.2|
Domain Number 1 Region: 12-135
Classification Level Classification E-value
Superfamily PIN domain-like 0.00000000000000897
Family PIN domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118431850|ref|NP_148567.2|
Sequence length 147
Comment hypothetical protein APE_2365.1 [Aeropyrum pernix K1]
Sequence
MEAHRLGAHKVVVLLDSNTLILMASGRIAPSMILEAINSSFKPATTSTVVAELRGLAEIH
RTRLLGRRAQTALRLLQQMGVEVIETESRDADDSLEEAAEKLKVEGAKVYVATSDRSLRR
RLRRRGVPTIYYRSSEARLEADWWDDL
Download sequence
Identical sequences Q9Y9C2
gi|118431850|ref|NP_148567.2| 272557.APE_2365.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]