SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118431934|ref|YP_874950.1| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431934|ref|YP_874950.1|
Domain Number 1 Region: 16-60
Classification Level Classification E-value
Superfamily SirA-like 0.0000183
Family SirA-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118431934|ref|YP_874950.1|
Sequence length 65
Comment hypothetical protein APE_2592a [Aeropyrum pernix K1]
Sequence
MPKIEAFETYVAQLARPGEVYEVVMRDPDTWLAVQRIAEDMGFEVLEAGRRDGEKVYYVR
IRLAV
Download sequence
Identical sequences Q05DW6
272557.APE_2592a gi|118431934|ref|YP_874950.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]