SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14600508|ref|NP_147024.1| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14600508|ref|NP_147024.1|
Domain Number 1 Region: 7-200
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.03e-19
Family TTHA0179-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|14600508|ref|NP_147024.1|
Sequence length 281
Comment molybdopterin-guanine dinucleotide biosynthesis protein MobA [Aeropyrum pernix K1]
Sequence
MNPIPADVAAVVLAGGVGRRFGRPKALAMMDGISLVERAVEALSSGPADVYVSVSPALER
PVARLVGSRRVIVDLVEQAPCEGPLRAFLTAASTLVSYSNLVFMPVDAPWASWRDLEPIY
NASKAIGSGASYFSGEGIVHPLFLAARRKSLLTAAWTACWGRAEKRASAILRSLDPLILL
GSSETRSPLALATVNTPQDLWRPSRVPAPAEGYILLEGHSILYKISSTMNSYYSALALEA
EYKLYRRLGLLRLASHVLKDAAALNVSTSLIQQESMAGGLG
Download sequence
Identical sequences Q9YFS1
gi|14600508|ref|NP_147024.1| APC22663 XR109 272557.APE_0179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]