SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14600753|ref|NP_147274.1| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14600753|ref|NP_147274.1|
Domain Number 1 Region: 3-76,159-328
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 1.14e-73
Family Pyruvate kinase 0.0000185
Further Details:      
 
Domain Number 2 Region: 71-156
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 5.76e-16
Family Pyruvate kinase beta-barrel domain 0.0016
Further Details:      
 
Domain Number 3 Region: 338-440
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 0.0000000000115
Family Pyruvate kinase, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14600753|ref|NP_147274.1|
Sequence length 458
Comment pyruvate kinase [Aeropyrum pernix K1]
Sequence
MRGPVKIVATVGPSSSSASILAQMLSLGVDVARINASHGGVEQWNSMLESLRRAEEAVGK
RVGVAVDLEGPRVRTGNSEPVKLEKGDLVTLGFMEGDVPVDARQFFETIDEGDIVLLDDG
KIILQVESVEGFRVKARVLEGGVLGPRKGVVVRGKEPDLPPLSAKDRRALEFFADKGVSH
VYVSFARSAEHVEKVRTVVRRLGLRQARIFAKIEGPSGVSRIGEIAEASDGVIIARGDLG
MHYSLEELPEIQELIVWEARKRYKTVVLATEFLSSMIEKPVPTRSEVVDIYQAVLQTADA
LMLTGETAIGKYPVKSVQWMAKISSRAYKKLATSPPERPRPTSTPYKLALGLVELAESLD
SPLVVYSKTGRFAERLASFKPLKTFYVGVPSREVERVVRHLWGAEPIVVGDYPYEAGLAK
TYEKLRRENIIHGDETVVEAAWSSERGIYIIRVRNLEF
Download sequence
Identical sequences Q9YEU2
ape001000489.1 272557.APE_0489 gi|14600753|ref|NP_147274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]