SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14601403|ref|NP_147939.1| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14601403|ref|NP_147939.1|
Domain Number 1 Region: 10-265
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.1e-72
Family G proteins 0.000004
Further Details:      
 
Domain Number 2 Region: 468-628
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.37e-54
Family Translational machinery components 0.0000106
Further Details:      
 
Domain Number 3 Region: 261-379
Classification Level Classification E-value
Superfamily Translation proteins 9.03e-27
Family Elongation factors 0.0013
Further Details:      
 
Domain Number 4 Region: 629-722
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.28e-23
Family EF-G/eEF-2 domains III and V 0.0047
Further Details:      
 
Domain Number 5 Region: 392-468
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.41e-21
Family EF-G/eEF-2 domains III and V 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14601403|ref|NP_147939.1|
Sequence length 736
Comment elongation factor EF-2 [Aeropyrum pernix K1]
Sequence
MGARVKVVSEIEKIMRNIDQIRNIGIIAHVDHGKTTTSDSLLAAAGIISERIAGEALVLD
YLNVEKQRGITVKSANVSLYHEYEGKPYVINLIDTPGHVDFSGKVTRSLRVLDGAIVVVD
AVEGVMTQTETVIRQALEERVRPILFINKVDRLIKELKLPPEKIQQRFVEIIKEVNNLID
LYAEPEFRKKWKLDPNAGMVAFGSAKDKWGISVPQVKKKGITFREIIQAYEKGKEAVAEL
SKKMPLHETLLDMVIKFVPNPREAQRYRIPKIWKGDINSEIGQAMLNADPDGPLVFFIND
VRIEKAGLVATGRVFSGTLRSGEEVYLLNAGKKSRLLQVSIYMGPFREVTKEIPAGNIGA
VMGFEDVRAGETVVSLGYEENAAPFESLRYVSEPVVTIAVEPVKIQDLPKMIEALRKLTI
EDPNLVVKINEETGEYLLSGMGPLHLEIALTMLREKFGVEVKASPPIVVYRETVRQQSRV
FEGKSPNKHNKLYISVEPLNEETITLIQNGAVTEDQDPKDRARILADKAGWDYNEARKIW
AIDENINVFVDKTAGVQYLREVKDTIIAGFRLALKEGPLAAEPVRGVKVVLHDAVIHEDP
VHRGPGQLYPAVRNAIWAGILDGRPTLLEPLQKLDIRAPMEYLSNITAVLTRKRGRIINV
ETTGVMARIIAAIPVAESFDLAGELRSATAGRAFWGVEFYGWAPVPDQMLQDLIAKIRQR
KGLPPSPPKIDDLIGP
Download sequence
Identical sequences Q9YC19
272557.APE_1432 gi|14601403|ref|NP_147939.1| XR131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]