SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14601412|ref|NP_147949.1| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14601412|ref|NP_147949.1|
Domain Number 1 Region: 10-186
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.52e-46
Family Ribonuclease PH domain 1-like 0.00000224
Further Details:      
 
Domain Number 2 Region: 154-240
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.01e-19
Family Ribonuclease PH domain 2-like 0.0000851
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14601412|ref|NP_147949.1|
Sequence length 246
Comment exosome complex exonuclease Rrp41 [Aeropyrum pernix K1]
Sequence
MAGPAQAGVELIRDGRRHDGRLPEDLRPVRMQVGILHNADGSALVEFGRTRVLAAVYGPR
EPHQRFYVLPDRAALRVRYHMAPFSTDERKSPAPSRREIELSKVVREALEPVVLAEEFPR
TVIDVFLEVLQADGGTRTAAVTAASLALADAGIPMRALVGGVAVGKIQGVLVVDVDELED
MYGEADMPVAAAPDIGEITLLQLNGVLTGEEFRTALAMALRAIDRVVEMEKEAIRKSYLE
VGGGQE
Download sequence
Identical sequences Q9YC03
gi|14601412|ref|NP_147949.1| 272557.APE_1447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]