SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14601452|ref|NP_147990.1| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14601452|ref|NP_147990.1|
Domain Number 1 Region: 62-136
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000553
Family GHMP Kinase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14601452|ref|NP_147990.1|
Sequence length 307
Comment hypothetical protein APE_1512 [Aeropyrum pernix K1]
Sequence
MGSVVYVEGGSRLHAGFHIVDPQRGVWGGAGFYVEEPRVRVEAWDCGEARWEVDSDIATL
LERAGLAWGCLKIASRPPRHMGLGSTTQLSLAASMALLALKGLRPSIPSLAARLGRGRFS
AVGTLLAVHGGFVLDSGSVSTPPISAVRVPEDWRFVLVIPQLEPGFEEGRAEDLALKTAG
LRAARGGDLRSRGALLLAVGIARGDLDIALEGLSSMQAGTGLLFQEVQGAVFRRDLMNIV
DEASRNGVKLAQSSWGPTLYTISHESTADSDARMLRAILRSHGIRGEVLVTRPRNKGLTL
EVGMDGG
Download sequence
Identical sequences Q9YBT7
gi|14601452|ref|NP_147990.1| 272557.APE_1512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]