SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14601519|ref|NP_148059.1| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|14601519|ref|NP_148059.1|
Domain Number - Region: 25-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0413
Family Z-DNA binding domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|14601519|ref|NP_148059.1|
Sequence length 148
Comment hypothetical protein APE_1617 [Aeropyrum pernix K1]
Sequence
MTRVDCGGSPTPIPEVLKHYPWLLPIFWIITRGVEEPGEITLETVSGRLGVPKRLARTLV
HYAVKAGILHRSGGSYKAYAPACIDVIDVRRKGRYYAAVVGDTVYVAKTLSRRVRWFTVP
REHIGELETLEGKARYRAVVAKKVLGDM
Download sequence
Identical sequences Q9YBI1
272557.APE_1617 gi|14601519|ref|NP_148059.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]