SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14601647|ref|NP_148188.1| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14601647|ref|NP_148188.1|
Domain Number 1 Region: 22-183,219-347
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.73e-41
Family tRNA pseudouridine synthase TruD 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14601647|ref|NP_148188.1|
Sequence length 363
Comment tRNA pseudouridine synthase D [Aeropyrum pernix K1]
Sequence
MYNAALPCRTADWALEELLGLPHARGPEALIMFPWGFRVVESRVDWEERRGWVLYLVRKR
LLSTPTAASVLSRLLGCRLYSYAGLKDACSVSWQHVSLYRCRRRPARVKAYNGRMEAWLL
KRGVYVYPGGHKGNMFSIRLETRGGCRASRLGWIPAHYGPQRFGVFRPNSHIYSILYSTG
KWDLLARELRYRYPLERRIGPGDYESRILADISRGLAPPLGQRLDSIIAEALRSYIFNRA
LTRAIELGASFWSLAEFEADTVCGSKTYKVPAVRLPSRLLYNTRTSWSRLVARVMEEDGI
DPGILPSRGGWRPLLYPVCRYRCRRVGDSELSIHLHLPPGAFATIALLAHYAILWMDSYA
DCS
Download sequence
Identical sequences Q9YAX6
272557.APE_1819 gi|14601647|ref|NP_148188.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]