SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|14602065|ref|NP_148611.1| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|14602065|ref|NP_148611.1|
Domain Number 1 Region: 3-171
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.87e-36
Family GHMP Kinase, N-terminal domain 0.0005
Further Details:      
 
Domain Number 2 Region: 181-321
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 9e-31
Family Mevalonate kinase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|14602065|ref|NP_148611.1|
Sequence length 324
Comment mevalonate kinase [Aeropyrum pernix K1]
Sequence
MRRAARASAPGKVIIVGEHFVVRGSLAIVAAIGRRLRVTVRSGGKGIVLESSMLGRHSAP
LPGQGAAAKVSPVLEPYIAVLRSLAARGYSVVPHTILVESGIPPRAGLGSSAASMVAYAL
SYSAMHGDPLSAEDLYSVAMEGEKIAHGKPSGVDVTIAVRGGVLAYRRGENPVDIRPGLT
GVTLLVADTGVERRTRDVVEHVLSIADALGEASTYIYRAADLIAREALHAIEKGDAERLG
LIMNAAQGLLSSLGASSLEIETLVYRMRSAGALGAKLTGAGWGGCVIGLFKEGEVERGLE
SVVESSSQAFTASIAEEGARLEEF
Download sequence
Identical sequences Q9Y946
gi|14602065|ref|NP_148611.1| 272557.APE_2439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]