SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118431412|ref|NP_147876.2| from Aeropyrum pernix K1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118431412|ref|NP_147876.2|
Domain Number 1 Region: 2-79,173-336
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.28e-57
Family Bacterial dinuclear zinc exopeptidases 0.00023
Further Details:      
 
Domain Number 2 Region: 67-178
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.24e-23
Family Aminopeptidase/glucanase lid domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118431412|ref|NP_147876.2|
Sequence length 341
Comment N-terminal deblocking aminopeptidase [Aeropyrum pernix K1]
Sequence
MSVLETLRELVFTPGPSGFEDLVRSVVVSRLRELGLDPVVDELGNVVVNPSGGEPRLLAA
AHMDELGFVITGVGDDGLLAFRKLGGIDDRILPGQHVEILLDGGARIEGVIGITPPHLQL
DRGEAEKPLRWHELRIDIGAQSRAEAEELGVKPLQPAVFKKHWSTLAGGRALASRGFDDR
AGVALLLELAKRIAEGRVDAGGIALAWTVQEEVGLRGASYVASRMKPKAFLAVDTMACCH
PAVTGHTRPGGGPVVRALDNQHITPRWLVELLEEAARSAGLELQYATAGGTTDAAAFQRT
GVPSAAIGIPLKYTHSTAEVLYLSDLEGALKLLEHLPGRLG
Download sequence
Identical sequences Q9YCC1
272557.APE_1335.1 gi|118431412|ref|NP_147876.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]