SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT1G02440.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G02440.1
Domain Number 1 Region: 14-186
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.21e-34
Family G proteins 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G02440.1
Sequence length 190
Sequence
MGTTLGKPFAGFFHQEEARIVLFGLGGTGKSSIMHKFKTGETLTTTMPTVGLNVESVKYK
DSNLCFWEMGGQQCYMWFPLWKHWFQEIAGLVLVVDSTGRDQIEETKDFLNVVIDEIQGS
VPDNAPVLVYGNKHEVPGAMSASEISNKLDLTSLRKKNWQRNWHVQSSCAFSGDGLHEGL
DWLLKNAERM
Download sequence
Identical sequences F4HXI5
AT1G02440.1 NP_563652.1.80155 3702.AT1G02440.1-P AT1G02440.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]