SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT1G16130.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G16130.1
Domain Number 1 Region: 399-687
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.22e-80
Family Protein kinases, catalytic subunit 0.0000932
Further Details:      
 
Weak hits

Sequence:  AT1G16130.1
Domain Number - Region: 301-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0241
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G16130.1
Sequence length 748
Sequence
MKTETHNRQCIPLAISVLSLFINGVSSARQPPDRCNRVCGEISIPFPFGIGGKDCYLNPW
YEVVCNSTNSVPFLSRINRELVNISLNGVVHIKAPVTSSGCSTGTSQPLTPPPLNVAGQG
SPYFLTDKNLLVAVGCKFKAVMAGITSQITSCESSCNERNSSSQEGRNKICNGYKCCQTR
IPEGQPQVISVDIEIPQGNNTTGEGGCRVAFLTSDKYSSLNVTEPEKFHGHGYAAVELGW
FFDTSDSRDTQPISCKNASDTTPYTSDTRCSCSYGYFSGFSYRDCYCNSPGYKGNPFLPG
GCVDVDECKLDIGRNQCKDQSCVNLPGWFDCQPKKPEQLKRVIQGVLIGSALLLFAFGIF
GLYKFVQKRRKLIRMRKFFRRNGGMLLKQQLARKEGNVEMSRIFSSHELEKATDNFNKNR
VLGQGGQGTVYKGMLVDGRIVAVKRSKAVDEDRVEEFINEVVVLAQINHRNIVKLLGCCL
ETEVPVLVYEFVPNGDLCKRLHDESDDYTMTWEVRLHIAIEIAGALSYLHSAASFPIYHR
DIKTTNILLDERNRAKVSDFGTSRSVTIDQTHLTTQVAGTFGYVDPEYFQSSKFTEKSDV
YSFGVVLVELLTGEKPSSRVRSEENRGLAAHFVEAVKENRVLDIVDDRIKDECNMDQVMS
VANLARRCLNRKGKKRPNMREVSIELEMIRSSHYDSGIHIEDDDEEDDQAMELNFNDTWE
VGATAPASMFNNASPTSDAEPLVPLRTW
Download sequence
Identical sequences Q7X8C5
AT1G16130.1 AT1G16130.1 NP_173064.1.80155 3702.AT1G16130.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]