SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT1G16260.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G16260.1
Domain Number 1 Region: 371-658
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.57e-80
Family Protein kinases, catalytic subunit 0.0000688
Further Details:      
 
Weak hits

Sequence:  AT1G16260.1
Domain Number - Region: 282-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00306
Family EGF-type module 0.0074
Further Details:      
 
Domain Number - Region: 261-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0281
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G16260.1
Sequence length 720
Sequence
MGVDVKRFLVVMLLLRICEYAAASTFPLALRNCSDHCGNVSVPYPFGIGKGCYKNKWFEI
VCKSSSDQQPILLLPRIRRAVTSFNLGDPFSISVYNKFYIQSPLKHSGCPNRDGYSSSSL
NLKGSPFFISENNKFTAVGCNNKAFMNVTGLQIVGCETTCGNEIRSYKGANTSCVGYKCC
QMTIPPLLQLQVFDATVEKLEPNKQGCQVAFLTQFTLSGSLFTPPELMEYSEYTTIELEW
RLDLSYMTSKRVLCKGNTFFEDSYQCSCHNGYEGNPYIPGGCQDIDECRDPHLNKCGKRK
CVNVLGSYRCEKTWPAILSGTLSSGLLLLIFGMWLLCKANRKRKVAKQKRKFFQRNGGLL
LQQQTSFLHGSVNRTKVFSSNDLENATDRFNASRILGQGGQGTVYKGMLEDGMIVAVKKS
KALKEENLEEFINEIILLSQINHRNVVKILGCCLETEVPILVYEFIPNRNLFDHLHNPSE
DFPMSWEVRLCIACEVADALSYLHSAVSIPIYHRDVKSTNILLDEKHRAKVSDFGISRSV
AIDDTHLTTIVQGTIGYVDPEYLQSNHFTGKSDVYSFGVLLIELLTGEKPVSLLRRQEVR
MLGAYFLEAMRNDRLHEILDARIKEECDREEVLAVAKLARRCLSLNSEHRPTMRDVFIEL
DRMQSKRKGTQSQAQNGEEHAHIQIAMPESMSLSYSSPNIVVENSSFSLDTKPLMPHKTQ
Download sequence
Identical sequences A0A178WDV6 Q9SA25
NP_001185009.1.80155 NP_173076.1.80155 AT1G16260.1 AT1G16260.2 AT1G16260.1 3702.AT1G16260.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]