SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G18335.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G18335.1
Domain Number 1 Region: 147-232
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000022
Family N-acetyl transferase, NAT 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G18335.1
Sequence length 269
Sequence
MDPSPTESLQTWRTNETEGRESSVWRAMDLKKRRKILEKKKTIHDLIKRASSIDDPLSPF
DSFRRYRRNDLSLYLESGRGDRLSSSVKHHIQKLLKTNMEGFYGSDWPIQAKVKRKEMSS
ADAHYIFVRELRFGKAYETSTQRTCMEGCNQIAGFVHYRFILEEEIPVLYVYEIQLESRV
QGKGLGEFLMQLIELIASKNRMSAIVLTVLTSNALAMTFYMSKLGYRISSISPSKANLPT
LSVKYEILCKTFDSEAKSVLENDEEPTKD
Download sequence
Identical sequences F4IAQ4
GO.2227 AT1G18335.1 NP_683313.2.80155 3702.AT1G18335.1-P AT1G18335.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]