SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT1G21210.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G21210.1
Domain Number 1 Region: 393-681
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-74
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 277-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  AT1G21210.1
Domain Number - Region: 243-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.026
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G21210.1
Sequence length 738
Sequence
MKVQRLFLVAIFCLSYMQLVKGQTLPRCPEKCGNVTLEYPFGFSPGCWRAEDPSFNLSCV
NENLFYKGLEVVEISHSSQLRVLYPASYICYNSKGKFAKGTYYWSNLGNLTLSGNNTITA
LGCNSYAFVSSNGTRRNSVGCISACDALSHEANGECNGEGCCQNPVPAGNNWLIVRSYRF
DNDTSVQPISEGQCIYAFLVENGKFKYNASDKYSYLQNRNVGFPVVLDWSIRGETCGQVG
EKKCGVNGICSNSASGIGYTCKCKGGFQGNPYLQNGCQDINECTTANPIHKHNCSGDSTC
ENKLGHFRCNCRSRYELNTTTNTCKPKGNPEYVEWTTIVLGTTIGFLVILLAISCIEHKM
KNTKDTELRQQFFEQNGGGMLMQRLSGAGPSNVDVKIFTEEGMKEATDGYDENRILGQGG
QGTVYKGILPDNSIVAIKKARLGDNSQVEQFINEVLVLSQINHRNVVKLLGCCLETEVPL
LVYEFISSGTLFDHLHGSMFDSSLTWEHRLRMAVEIAGTLAYLHSSASIPIIHRDIKTAN
ILLDENLTAKVADFGASRLIPMDKEDLATMVQGTLGYLDPEYYNTGLLNEKSDVYSFGVV
LMELLSGQKALCFERPQTSKHIVSYFASATKENRLHEIIDGQVMNENNQREIQKAARIAV
ECTRLTGEERPGMKEVAAELEALRVTKTKHKWSDEYPEQEDTEHLVGVQKLSAQGETSSS
IGYDSIRNVAILDIEAGR
Download sequence
Identical sequences Q9LMN6
NP_173544.1.80155 AT1G21210.1 3702.AT1G21210.1-P AT1G21210.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]