SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT1G21770.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G21770.1
Domain Number 1 Region: 11-98
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.61e-27
Family N-acetyl transferase, NAT 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G21770.1
Sequence length 111
Sequence
MATGTATEKPKIVWNEGRHRFETDDHEAFIEYKMKNDGKVMDLVRTFVPPSKAGLGLASH
LCVAAFEHASEHSFSIIPTCSYVSETFLHRNPTWQRLVHSEDDSKNLKSSI
Download sequence
Identical sequences Q8H0Y9
AT1G21770.1 3702.AT1G21770.1-P NP_564151.1.80155 AT1G21770.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]