SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT1G22720.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G22720.1
Domain Number 1 Region: 121-206
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.03e-19
Family Protein kinases, catalytic subunit 0.0028
Further Details:      
 
Weak hits

Sequence:  AT1G22720.1
Domain Number - Region: 19-52
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00379
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 92-133
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 0.00403
Family Phosphoglucomutase, C-terminal domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G22720.1
Sequence length 219
Sequence
MIIKSSAHSTGNPYVLNGCKDIDECKELANGRPNICTDGGTCQNSPESYRCDLRDQKESD
DPHLCRTTIGVLIVLLVIVSCIKQKIKHRKDIELRQIFFEQNGGGMLIHRLSGSGPSNVD
VKIFTEEAMKEATNSYDESRILGQGGQGKVYKGILSDNFIVAIKKARLGDSSQVEHFINE
VLILSQINHMNVIKILGCCLEIELFLLQLALGSLVIRHS
Download sequence
Identical sequences F4I2Z2
AT1G22720.1 AT1G22720.1 3702.AT1G22720.1-P NP_173686.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]