SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT1G30900.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G30900.1
Domain Number 1 Region: 53-181
Classification Level Classification E-value
Superfamily PA domain 0.000000017
Family PA domain 0.013
Further Details:      
 
Weak hits

Sequence:  AT1G30900.1
Domain Number - Region: 506-555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00281
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G30900.1
Sequence length 631
Sequence
MSLIHKGATLALFLALTMVVNGVFGRFIVEKSSVTILNPLAMRSKHDAAIANFGVPNYGG
YMIGSVVYAGQGAYGCDSFDKTFKPKFPRPTILIIDRGECYFALKVWNGQQSGVAAVLVA
DNVDEPLITMDSPEESKEADDFIEKLNIPSALIDFSFANTLKQALKKGEEVVLKIDWSES
LPHPDERVEYELWTNTNDECGARCDEQMNFVKNFKGHAQILEKGGYSLFTPHYITWFCPK
DYVSSNQCKSQCINQGRYCAPDPEQDFGDGYDGKDIVFENLRQLCVHKVAKENNRSWVWW
DYVTDFHIRCSMKEKKYSKECAERVVESLGLPLDKIKKCIGDPDANVENEVLKAEQALQV
GQGDRGDVTILPTLIVNNAQYRGKLERNAVLKAICSGFKERTEPGICLSGDIETNECLEA
NGGCWEDKKSNVTACKDTFRGRVCECPVVNGVQYKGDGYTSCEPYGPARCSINQGGCWSE
TKKGLTFSACSNLETSGCRCPPGFKGDGLKCEDIDECKEQSACQCDGCNCKNKWGGFECK
CSGNRLYMKEQDTCIERSGSRIGWFPTFVILAAVASICVGGYVFYKYRLRSYMDSEIMAI
MSQYMPLESQNTTDPMTGESQHQQLRLTSAA
Download sequence
Identical sequences Q9FYH7
AT1G30900.1 NP_174375.1.80155 AT1G30900.1 3702.AT1G30900.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]