SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT1G32070.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G32070.2
Domain Number 1 Region: 173-248
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.89e-18
Family N-acetyl transferase, NAT 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G32070.2
Sequence length 258
Sequence
MLLIPISSSSSSSISPPPNSYPSNHHSLFFSNLTFPIQHGSRKLKTLRLRANFWESIRSG
FVKNNNSTQLVEPPSIVNDEEEETEPLLPVEFTLVERNLEDGLVEEIIFSSGGEIDVYDL
QGLCDKVGWPRRPLVKLAAALKNSYMVATLHSVMKSSSDSDSSEGGDGEKQQEKKLIGMA
RATSDHAFNATIWDVLVDPEYQGQGLGKALVEKLVRALLQRDIGNISLFADSQVVDFYQN
LGFEADPEGIKGMFWYPK
Download sequence
Identical sequences Q7X9V3
NP_973950.1.80155 3702.AT1G32070.2-P AT1G32070.2 AT1G32070.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]