SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT1G79670.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G79670.2
Domain Number 1 Region: 366-654
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-80
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Weak hits

Sequence:  AT1G79670.2
Domain Number - Region: 269-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0122
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT1G79670.2
Sequence length 714
Sequence
MKRRRLFFSVLLSILTLFINGPLITTAQSPPSSSTSCNRICGGIEIPFPFGIGRRDCFLN
DWYEVVCNSTTSGKSLAPFLYKINRELVSITLRSSIDSSYGVVHIKSPVTSSGCSQRPVK
PLPLNLTGKGSPFFITDSNRLVSVGCQAKIPADRPQVIGVDLESSGGNTTQGGNCKVAFL
TNETYSPANVTEPEQFYTNGFTVIELGWYFDTSDSRLTNPVGCVNLTETGIYTSAPSCVC
EYGNFSGFGYSNCYCNQIGYRGNPYLPGGCIDIDECEEGKGLSSCGELTCVNVPGSWRCE
LNGVGKIKPLFPGLVLGFPLLFLVLGIWGLIKFVKKRRKIIRKRMFFKRNGGLLLKQQLT
TRGGNVQSSKIFSSKELEKATDNFNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDED
KVEEFINEVGVLSQINHRNIVKLMGCCLETEVPILVYEHIPNGDLFKRLHHDSDDYTMTW
DVRLRISVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTH
LTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHF
NEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSVELERIRSS
PEDLELHIEEEDEEECAMEINMDDSWSVDMTAPASLFDLSPKLDVEPLVPQRTW
Download sequence
Identical sequences F4IF87
AT1G79670.2 NP_849908.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]