SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT2G30290.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G30290.2
Domain Number 1 Region: 78-161
Classification Level Classification E-value
Superfamily PA domain 0.00000562
Family PA domain 0.011
Further Details:      
 
Weak hits

Sequence:  AT2G30290.2
Domain Number - Region: 512-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0107
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 490-519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0188
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 313-395
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0783
Family Thioltransferase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G30290.2
Sequence length 641
Sequence
MRTTNVWLVVIVWVTVGWSSCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSM
SGAVVYPKTNQKACKNFDDFEISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATIL
VADNRPEQLITMDAPEDETSDADYLQNITIPSALVSRSLGSAIKTAIAHGDPVHISLDWR
EALPHPNDRVAYELWTNSNDECGSKCDAQIRFLKRFKGAAQILEKGGYTRFTPHYITWYC
PEAFLASRQCKTQCINGGRYCAPDPEQDFSRGYNGKDVIIQNLRQACFFRVTNESGKPWL
WWDYVTDFAIRCPMKEEKYNKKCADQVIQSLGVDVKKIDKCIGDIDANAENPVLKEEQVA
QVGKGSRGDVTILPTIVINNRQYRGKLQRSAVLKALCSGFRETTEPPICLTEDIETNECL
QNNGGCWEDKTTNITACRDTFRGRVCQCPIVQGVKFLGDGYTHCEASGALRCGINNGGCW
KQTQMGKTYSACRDDHSKGCKCPPGFIGDGLKECKDVNECEEKTACQCRDCKCKNTWGSY
ECSCSGSLLYIREHDICINRDARGDFSWGVIWIIIMGLGAAALGAYTVYKYRIRTYMDSE
IRAIMAQYMPLDNNPNTQLSSQLELENAKYVESDFNLFLLS
Download sequence
Identical sequences F4IMR9
AT2G30290.2 AT2G30290.2 NP_001189637.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]