SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT2G32030.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G32030.1
Domain Number 1 Region: 23-182
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.23e-43
Family N-acetyl transferase, NAT 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G32030.1
Sequence length 188
Sequence
MEMDSTTTIKPETLSTVSSSPPEKIHLRPMTLSDVDDFMVWATDSNVTRFCTWEPYTSRE
AAIAYLNDALLPHPWLRAICLDNDRPIGSISVTPVDEIRGEIGYVLGSKYWGKGIATEAV
RLVAGEIFKEKPEMQRLEALVDVDNVGSQKVLEKVGFVKEGVMRKFMYLKGNVRDMVMFS
FLPSDSLH
Download sequence
Identical sequences A0A178VTR0 Q9SKZ6
AT2G32030.1 AT2G32030.1 3702.AT2G32030.1-P NP_180763.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]