SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT2G32645.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G32645.1
Domain Number 1 Region: 12-126
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000569
Family B3 DNA binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT2G32645.1
Sequence length 189
Sequence
MRNENGYNPKLISTRELFKSDLDKGKARLQVPFNQVKTPDFLTEDETRIIHENAMKIRDD
GVPVNLVDPRMNKHALELRKWKMKGNWNYVFVKGWNDVLDANKSNSFKEKDVFPLWSFRS
GTGKLCFALTPKIPATALLQENLAVAAMVLLLEVNLVRTKERELVFLYYHKKIHQATTTH
NKCKVSWLY
Download sequence
Identical sequences Q1G3B8
AT2G32645.1 AT2G32645.1 3702.AT2G32645.1-P NP_001118432.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]