SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT2G39030.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G39030.1
Domain Number 1 Region: 26-87,123-217
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 7.14e-28
Family N-acetyl transferase, NAT 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT2G39030.1
Sequence length 228
Sequence
MAPPTAAPEPNTVPETSPTGHRMFSRIRLATPTDVPFIHKLIHQMAVFERLTHLFVATES
GLASTLFNSRPFQAVTVFLLEISPSPFPTTHDASSPDFTPFLETHKVDLPIEDPDREKFL
PDKLNDVVVAGFVLFFPNYPSFLAKQGFYIEDIFMREPYRRKGFGKLLLTAVAKQAVKLG
VGRVEWIVIDWNVNAINFYEQMGAQVFKEWRLCRLTGDALQAIDKLNI
Download sequence
Identical sequences Q9ZV05
AT2G39030.1 NP_565898.1.80155 3702.AT2G39030.1-P GO.10240 AT2G39030.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]